"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0DJL7"	"{'domain_architectures': 1114, 'entries': 24, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 24, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 3, 'pfam': 3, 'profile': 1, 'smart': 2, 'panther': 1, 'interpro': 11}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1114}"	"['Iron-binding repressor of the dipheteria toxin gene expression. May serve as a global regulator of gene expression. Represses ripA under iron excess']"	"dtxR"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046914', 'name': 'transition metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"DTXR_CORDI"	"cc0452815701435fe8fa83d0078a95c9591031ec"	True	False	False	226	"Diphtheria toxin repressor"	1	"UP000002198"	"MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELIDDLAHTIRIEEL"	"reviewed"	"{'taxId': '257309', 'scientificName': 'Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)', 'fullName': 'Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)'}"