GET /api/protein/UniProt/P0CZ75/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0CZ75",
"id": "AROD_STRPQ",
"source_organism": {
"taxId": "193567",
"scientificName": "Streptococcus pyogenes serotype M3 (strain SSI-1)",
"fullName": "Streptococcus pyogenes serotype M3 (strain SSI-1)"
},
"name": "3-dehydroquinate dehydratase",
"description": [
"Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate"
],
"length": 228,
"sequence": "MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN",
"proteome": null,
"gene": "aroD",
"go_terms": [
{
"identifier": "GO:0003855",
"name": "3-dehydroquinate dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f6fd5e9c3640b884517a325ece5a5f3e7c533e37",
"counters": {
"domain_architectures": 6751,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6751
}
}
}