"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0CZ75"	"{'domain_architectures': 6751, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6751}"	"['Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate']"	"aroD"	"[{'identifier': 'GO:0003855', 'name': '3-dehydroquinate dehydratase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"AROD_STRPQ"	"f6fd5e9c3640b884517a325ece5a5f3e7c533e37"	True	False	False	228	"3-dehydroquinate dehydratase"	3	""	"MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN"	"reviewed"	"{'taxId': '193567', 'scientificName': 'Streptococcus pyogenes serotype M3 (strain SSI-1)', 'fullName': 'Streptococcus pyogenes serotype M3 (strain SSI-1)'}"
