General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0ADZ7",
        "id": "YAJC_ECOLI",
        "source_organism": {
            "taxId": "83333",
            "scientificName": "Escherichia coli (strain K12)",
            "fullName": "Escherichia coli (strain K12)"
        },
        "name": "Sec translocon accessory complex subunit YajC",
        "description": [
            "The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes (PubMed:27435098). The SecYEG complex is essential for assembly of a number of proteins and complexes, assembly is facilitated in the presence of the SecDF-YajC-YidC subcomplex (PubMed:27435098)"
        ],
        "length": 110,
        "sequence": "MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL",
        "proteome": "UP000000625",
        "gene": "yajC",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4d6d52104a4c27c5d71c0661887d0e1767017e4d",
        "counters": {
            "domain_architectures": 22525,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22525
        }
    }
}