GET /api/protein/UniProt/P0ADZ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0ADZ7",
"id": "YAJC_ECOLI",
"source_organism": {
"taxId": "83333",
"scientificName": "Escherichia coli (strain K12)",
"fullName": "Escherichia coli (strain K12)"
},
"name": "Sec translocon accessory complex subunit YajC",
"description": [
"The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes (PubMed:27435098). The SecYEG complex is essential for assembly of a number of proteins and complexes, assembly is facilitated in the presence of the SecDF-YajC-YidC subcomplex (PubMed:27435098)"
],
"length": 110,
"sequence": "MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL",
"proteome": "UP000000625",
"gene": "yajC",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4d6d52104a4c27c5d71c0661887d0e1767017e4d",
"counters": {
"domain_architectures": 22525,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 1,
"taxa": 1,
"dbEntries": {
"smart": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22525
}
}
}