"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0ADZ7"	"{'domain_architectures': 22525, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'smart': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'prints': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22525}"	"['The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes (PubMed:27435098). The SecYEG complex is essential for assembly of a number of proteins and complexes, assembly is facilitated in the presence of the SecDF-YajC-YidC subcomplex (PubMed:27435098)']"	"yajC"	""	"YAJC_ECOLI"	"4d6d52104a4c27c5d71c0661887d0e1767017e4d"	True	False	False	110	"Sec translocon accessory complex subunit YajC"	1	"UP000000625"	"MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"