GET /api/protein/UniProt/P0A1Z9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0A1Z9",
"id": "CSGC_SALEN",
"source_organism": {
"taxId": "149539",
"scientificName": "Salmonella enteritidis",
"fullName": "Salmonella enteritidis"
},
"name": "Curli assembly protein CsgC",
"description": [
"Plays a role in the extracellular assembly of CsgA (also known as AgfA, AC P0A1E7) into thin aggregative fimbriae (Tafi) fibers. Assembly may also require CsgE (AgfE). Tafi are thought to be assembled via an extracellular nucleation-precipitation (ENP) pathway, and possibly also via an intracellular non-CsgC-dependent pathway"
],
"length": 108,
"sequence": "MHTLLLLAALSNQITFTTTQQGDIYTVIPQVTLNEPCVCQVQILSVRDGVGGQSHTQQKQTLSLPANQPIELSRLSVNISSEDSVKIIVTVSDGQSLHLSQQWPPSAQ",
"proteome": null,
"gene": "csgC",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "32f5ba0faa27ffa931bd00908bae8fce7046dc92",
"counters": {
"domain_architectures": 733,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ncbifam": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 733
}
}
}