"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0A1Z9"	"{'domain_architectures': 733, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 733}"	"['Plays a role in the extracellular assembly of CsgA (also known as AgfA, AC P0A1E7) into thin aggregative fimbriae (Tafi) fibers. Assembly may also require CsgE (AgfE). Tafi are thought to be assembled via an extracellular nucleation-precipitation (ENP) pathway, and possibly also via an intracellular non-CsgC-dependent pathway']"	"csgC"	""	"CSGC_SALEN"	"32f5ba0faa27ffa931bd00908bae8fce7046dc92"	True	False	False	108	"Curli assembly protein CsgC"	1	""	"MHTLLLLAALSNQITFTTTQQGDIYTVIPQVTLNEPCVCQVQILSVRDGVGGQSHTQQKQTLSLPANQPIELSRLSVNISSEDSVKIIVTVSDGQSLHLSQQWPPSAQ"	"reviewed"	"{'taxId': '149539', 'scientificName': 'Salmonella enteritidis', 'fullName': 'Salmonella enteritidis'}"