General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P09501",
        "id": "TGB3_WCMVM",
        "source_organism": {
            "taxId": "12189",
            "scientificName": "White clover mosaic virus (strain M)",
            "fullName": "White clover mosaic virus (strain M) (WCMV)"
        },
        "name": "Movement protein TGBp3",
        "description": [
            "Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments (By similarity)"
        ],
        "length": 66,
        "sequence": "MDFTTLIIIGVYLLVFIVYFAKINTSVCTISISGASIEISGCDNPTLFEILPKLRPFNHGLSLPSN",
        "proteome": "UP000007627",
        "gene": "ORF4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "a69303c0375ecc317a2e98969cc884266e447026",
        "counters": {
            "domain_architectures": 1283,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1283
        }
    }
}