"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P09501"	"{'domain_architectures': 1283, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1283}"	"['Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments (By similarity)']"	"ORF4"	""	"TGB3_WCMVM"	"a69303c0375ecc317a2e98969cc884266e447026"	False	False	False	66	"Movement protein TGBp3"	3	"UP000007627"	"MDFTTLIIIGVYLLVFIVYFAKINTSVCTISISGASIEISGCDNPTLFEILPKLRPFNHGLSLPSN"	"reviewed"	"{'taxId': '12189', 'scientificName': 'White clover mosaic virus (strain M)', 'fullName': 'White clover mosaic virus (strain M) (WCMV)'}"