GET /api/protein/UniProt/P03639/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P03639",
        "id": "LYS_BPPHS",
        "source_organism": {
            "taxId": "1217068",
            "scientificName": "Enterobacteria phage phiX174 (Isolate Sanger)",
            "fullName": "Enterobacteria phage phiX174 (Isolate Sanger)"
        },
        "name": "Lysis protein E",
        "description": [
            "Induces host cell lysis (PubMed:10760296, PubMed:11078734, PubMed:19379010, PubMed:37440661). Inhibits the host translocase MraY activity that catalyzes the synthesis of lipid I, a necessary step for the host cell wall biosynthesis (PubMed:11078734, PubMed:19379010, PubMed:37440661)"
        ],
        "length": 91,
        "sequence": "MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNLRKTLLMASSVRLKPLNCSRLPCVYAQETLTFLLTQKKTCVKNYVQKE",
        "proteome": "UP000005893",
        "gene": "E",
        "go_terms": [
            {
                "identifier": "GO:0004857",
                "name": "enzyme inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "9983caa9ea37081156e8d40b1c2aa2353e0df0f3",
        "counters": {
            "domain_architectures": 110,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 110
        }
    }
}