"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P03639"	"{'domain_architectures': 110, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 110}"	"['Induces host cell lysis (PubMed:10760296, PubMed:11078734, PubMed:19379010, PubMed:37440661). Inhibits the host translocase MraY activity that catalyzes the synthesis of lipid I, a necessary step for the host cell wall biosynthesis (PubMed:11078734, PubMed:19379010, PubMed:37440661)']"	"E"	"[{'identifier': 'GO:0004857', 'name': 'enzyme inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"LYS_BPPHS"	"9983caa9ea37081156e8d40b1c2aa2353e0df0f3"	False	False	False	91	"Lysis protein E"	1	"UP000005893"	"MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNLRKTLLMASSVRLKPLNCSRLPCVYAQETLTFLLTQKKTCVKNYVQKE"	"reviewed"	"{'taxId': '1217068', 'scientificName': 'Enterobacteria phage phiX174 (Isolate Sanger)', 'fullName': 'Enterobacteria phage phiX174 (Isolate Sanger)'}"