General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P00305",
        "id": "ICYA_MANSE",
        "source_organism": {
            "taxId": "7130",
            "scientificName": "Manduca sexta",
            "fullName": "Manduca sexta (Tobacco hawkmoth)"
        },
        "name": "Insecticyanin-A",
        "description": [
            "This protein binds a chromophore: biliverdin IX, isomer gamma. Mixed with lipoprotein-bound carotenes, this blue protein provides hornworms with their green cryptic coloration which serves a camouflage"
        ],
        "length": 189,
        "sequence": "GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAKLPLENENQGKCTIAEYKYDGKKASVYNSFVSNGVKEYMEGDLEIAPDAKYTKQGKYVMTFKFGQRVVNLVPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEGNTKEVVDNVLKTFSHLIDASKFISNDFSEAACQYSTTYSLTGPDRH",
        "proteome": null,
        "gene": "INSA",
        "go_terms": [
            {
                "identifier": "GO:0031409",
                "name": "pigment binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ba10142da31472221cfebba1b934f343d27763b",
        "counters": {
            "domain_architectures": 23661,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23661
        }
    }
}