"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P00305"	"{'domain_architectures': 23661, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 23661}"	"['This protein binds a chromophore: biliverdin IX, isomer gamma. Mixed with lipoprotein-bound carotenes, this blue protein provides hornworms with their green cryptic coloration which serves a camouflage']"	"INSA"	"[{'identifier': 'GO:0031409', 'name': 'pigment binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ICYA_MANSE"	"8ba10142da31472221cfebba1b934f343d27763b"	True	False	False	189	"Insecticyanin-A"	1	""	"GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAKLPLENENQGKCTIAEYKYDGKKASVYNSFVSNGVKEYMEGDLEIAPDAKYTKQGKYVMTFKFGQRVVNLVPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEGNTKEVVDNVLKTFSHLIDASKFISNDFSEAACQYSTTYSLTGPDRH"	"reviewed"	"{'taxId': '7130', 'scientificName': 'Manduca sexta', 'fullName': 'Manduca sexta (Tobacco hawkmoth)'}"