General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O03070",
        "id": "ATPB_HYPHO",
        "source_organism": {
            "taxId": "58521",
            "scientificName": "Hypolepis hostilis",
            "fullName": "Hypolepis hostilis (Fern)"
        },
        "name": "ATP synthase subunit beta, chloroplastic",
        "description": [
            "Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits (By similarity)"
        ],
        "length": 208,
        "sequence": "KPDVLPFIDNLLRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGSSQERITSTKDGSITSIQAVYVPADDPTDPAPATTSAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMSQPWIVGEEHYETAQGVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPSFVAEVFTGSPGKYVSLPETIKGFQMILPGXLDNLPEQ",
        "proteome": null,
        "gene": "atpB",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "09b56d2b536f46f26a97332d3d29690e29f7828f",
        "counters": {
            "domain_architectures": 7029,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7029
        }
    }
}