"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"O03070"	"{'domain_architectures': 7029, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 2, 'cdd': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 7029}"	"['Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits (By similarity)']"	"atpB"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ATPB_HYPHO"	"09b56d2b536f46f26a97332d3d29690e29f7828f"	False	False	True	208	"ATP synthase subunit beta, chloroplastic"	3	""	"KPDVLPFIDNLLRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGSSQERITSTKDGSITSIQAVYVPADDPTDPAPATTSAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMSQPWIVGEEHYETAQGVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPSFVAEVFTGSPGKYVSLPETIKGFQMILPGXLDNLPEQ"	"reviewed"	"{'taxId': '58521', 'scientificName': 'Hypolepis hostilis', 'fullName': 'Hypolepis hostilis (Fern)'}"