HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M9U8Y6",
"id": "M9U8Y6_SACIS",
"source_organism": {
"taxId": "1241935",
"scientificName": "Saccharolobus islandicus LAL14/1",
"fullName": "Saccharolobus islandicus LAL14/1"
},
"name": "Diphthine synthase",
"description": [
"S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis"
],
"length": 257,
"sequence": "MSILSLVGLGISKKFITENAIDTLNNSDIIIFDKYTSRSCDINVDVLRRLVKGGKTLIEADRSLLENNSKIIMDYLDKNYNVSIASIGDVLIATTHVSLLIEAKQRGHNVKVIPGISVHCYLISKSLLSSYKFGKSVTVTFPYNDFIDPTPYNVIKDNKERGLHTILYLDLKSERAMTANEALQILLRLEDKHRKNVLSKSDIVIVGARLGCDDEKIVALTVEEATLYDFGNTPHIIIIPGNLHYMEADAIKWMLMS",
"proteome": null,
"gene": "dphB",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004164",
"name": "diphthine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0017183",
"name": "protein histidyl modification to diphthamide",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c6fc4066a6a3d3c96c9a871fe22501df278bed0f",
"counters": {
"domain_architectures": 80154,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 1,
"cdd": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 80154
}
}
}