GET /api/protein/UniProt/M7TCG5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M7TCG5",
"id": "M7TCG5_BOTF1",
"source_organism": {
"taxId": "1290391",
"scientificName": "Botryotinia fuckeliana (strain BcDW1)",
"fullName": "Botryotinia fuckeliana (strain BcDW1) (Noble rot fungus)"
},
"name": "Cytosine deaminase",
"description": [
"Catalyzes the hydrolytic deamination of cytosine to uracil or 5-methylcytosine to thymine. Is involved in the pyrimidine salvage pathway, which allows the cell to utilize cytosine for pyrimidine nucleotide synthesis"
],
"length": 159,
"sequence": "MASLSDQEAFAIAVEEAKIGYEEGGVPIGAALVSRDGKLLGRGHNMRVQKGSAIHHGETSALENSGRLPASAYKGSTMYTTLSPCDMCTGACLLYGISRVVVGENNTFLGGEAYLKQRGIEVVNMQSKECQELMEKFISEKPELWNEDIGVEKRVHTKE",
"proteome": null,
"gene": "BcDW1_10246",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f99539802ad74cdae12e721eaf57a43643662eeb",
"counters": {
"domain_architectures": 85233,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 85233
}
}
}