"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M7TCG5"	"{'domain_architectures': 85233, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 85233}"	"['Catalyzes the hydrolytic deamination of cytosine to uracil or 5-methylcytosine to thymine. Is involved in the pyrimidine salvage pathway, which allows the cell to utilize cytosine for pyrimidine nucleotide synthesis']"	"BcDW1_10246"	""	"M7TCG5_BOTF1"	"f99539802ad74cdae12e721eaf57a43643662eeb"	True	False	False	159	"Cytosine deaminase"	3	""	"MASLSDQEAFAIAVEEAKIGYEEGGVPIGAALVSRDGKLLGRGHNMRVQKGSAIHHGETSALENSGRLPASAYKGSTMYTTLSPCDMCTGACLLYGISRVVVGENNTFLGGEAYLKQRGIEVVNMQSKECQELMEKFISEKPELWNEDIGVEKRVHTKE"	"unreviewed"	"{'taxId': '1290391', 'scientificName': 'Botryotinia fuckeliana (strain BcDW1)', 'fullName': 'Botryotinia fuckeliana (strain BcDW1) (Noble rot fungus)'}"