General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M7BGN1",
        "id": "M7BGN1_CHEMY",
        "source_organism": {
            "taxId": "8469",
            "scientificName": "Chelonia mydas",
            "fullName": "Chelonia mydas (Green sea-turtle)"
        },
        "name": "Kynurenine--oxoglutarate transaminase 3",
        "description": [
            "Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA), an intermediate in the tryptophan catabolic pathway which is also a broad spectrum antagonist of the three ionotropic excitatory amino acid receptors among others. May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro)"
        ],
        "length": 398,
        "sequence": "VEFTKVAADPSVVNLGQGLPDISPPSYVKEELAKAATVDKLNQYTRGFGHPLLVKALSQVYEKVCGRKIDPYTDVLVTVGGYGSLFSAIQGLIEAGDEVIIIEPFFDCYEPMVKMAGGKPVFIPLRYKTVIGNSASSADWVLDATELASKFNSRTKAILLNTPHNPIGKVFTKEELQVIADLCIKHDTLCFSDEVYEWLVYKGNKHIKIATLPGMWERTITIGSAGKTYSVTGWKLGWSIGPQHLIKHLQVVQQNTLYACPTPLQEALAQALWIDFKRMDDPDCYFYSLSRELEGKRNRMAQLLQEVGLKPVIPDGGYFMIVDVSALNVDLSDMEANQHYDYKFVKWMIKSKKLSAIPLTAFCGPDTKKQFEKYIRFCFIKQDSTLDAAEVILKNWNK",
        "proteome": "UP000031443",
        "gene": "UY3_15541",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
        "counters": {
            "domain_architectures": 344728,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 344728
        }
    }
}