General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M4C7M1",
        "id": "M4C7M1_BRACM",
        "source_organism": {
            "taxId": "3711",
            "scientificName": "Brassica campestris",
            "fullName": "Brassica campestris (Field mustard)"
        },
        "name": "Response regulatory domain-containing protein",
        "description": [
            "Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling"
        ],
        "length": 161,
        "sequence": "MNSGSCSSLMEVGYDDHHHHHGHEELHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLSDVEKLKCHLMNCRS",
        "proteome": "UP000011750",
        "gene": "BRAPAZ1V2_A03P22660.2",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009736",
                "name": "cytokinin-activated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2b3543d858b8ab91bbdca9e4d43b1a8c5763b553",
        "counters": {
            "domain_architectures": 192712,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 192712
        }
    }
}