GET /api/protein/UniProt/M4C7M1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M4C7M1",
"id": "M4C7M1_BRACM",
"source_organism": {
"taxId": "3711",
"scientificName": "Brassica campestris",
"fullName": "Brassica campestris (Field mustard)"
},
"name": "Response regulatory domain-containing protein",
"description": [
"Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling"
],
"length": 161,
"sequence": "MNSGSCSSLMEVGYDDHHHHHGHEELHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLSDVEKLKCHLMNCRS",
"proteome": "UP000011750",
"gene": "BRAPAZ1V2_A03P22660.2",
"go_terms": [
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009736",
"name": "cytokinin-activated signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2b3543d858b8ab91bbdca9e4d43b1a8c5763b553",
"counters": {
"domain_architectures": 192712,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 192712
}
}
}