"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M4C7M1"	"{'domain_architectures': 192712, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 192712}"	"['Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling']"	"BRAPAZ1V2_A03P22660.2"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009736', 'name': 'cytokinin-activated signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"M4C7M1_BRACM"	"2b3543d858b8ab91bbdca9e4d43b1a8c5763b553"	True	False	False	161	"Response regulatory domain-containing protein"	3	"UP000011750"	"MNSGSCSSLMEVGYDDHHHHHGHEELHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLSDVEKLKCHLMNCRS"	"unreviewed"	"{'taxId': '3711', 'scientificName': 'Brassica campestris', 'fullName': 'Brassica campestris (Field mustard)'}"