General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M2ULM9",
        "id": "M2ULM9_COCH5",
        "source_organism": {
            "taxId": "701091",
            "scientificName": "Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)",
            "fullName": "Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus)"
        },
        "name": "Cysteine dioxygenase",
        "description": null,
        "length": 194,
        "sequence": "VNQFEKLVTALKDALGSSGLTSEDIDIKLLNRLMQDYRSNEDEWRRFALVDPNSGYTRNLVDQGNGKSNLLLLVWAPGKGSLIHSHSNAHCLMKILYGQLTETRYEFPGKANSPEDHASMTTISEKVHVEDQVAYMNDDLGVHKMWNNGIDYAVSLHLYTPPNIVRHGCFIFDEATGERTHVQTFENFSFRGKR",
        "proteome": "UP000016936",
        "gene": "COCHEDRAFT_1076640",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016702",
                "name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f18b62fdea65a76c903781b2dd90a0625a3417fc",
        "counters": {
            "domain_architectures": 10812,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10812
        }
    }
}