"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M2ULM9"	"{'domain_architectures': 9016, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9016}"	""	"COCHEDRAFT_1076640"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016702', 'name': 'oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M2ULM9_COCH5"	"f18b62fdea65a76c903781b2dd90a0625a3417fc"	True	True	194	"Cysteine dioxygenase"	3	"UP000016936"	"VNQFEKLVTALKDALGSSGLTSEDIDIKLLNRLMQDYRSNEDEWRRFALVDPNSGYTRNLVDQGNGKSNLLLLVWAPGKGSLIHSHSNAHCLMKILYGQLTETRYEFPGKANSPEDHASMTTISEKVHVEDQVAYMNDDLGVHKMWNNGIDYAVSLHLYTPPNIVRHGCFIFDEATGERTHVQTFENFSFRGKR"	"unreviewed"	"{'taxId': '701091', 'scientificName': 'Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)', 'fullName': 'Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus)'}"
