GET /api/protein/UniProt/M2SNG9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M2SNG9",
        "id": "M2SNG9_COCSN",
        "source_organism": {
            "taxId": "665912",
            "scientificName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652)",
            "fullName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus)"
        },
        "name": "Prefoldin subunit 4",
        "description": [
            "Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins"
        ],
        "length": 136,
        "sequence": "MQRRMLTKDDEATAQSEDLEVRREDQEKINRFSSLHQKEEILEEELRAKIKEKEDLEEISGELELVDEEEKVPYKVGDCFISLPQPQVLELLSSSTEAIEGEVDALKTKLEGIQEEMGELKKALYGRFGRSINLET",
        "proteome": "UP000016934",
        "gene": "COCSADRAFT_41790",
        "go_terms": [
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016272",
                "name": "prefoldin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0051082",
                "name": "unfolded protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "36da8b118b3212d7c40ed89855e8fd9deedb7b2d",
        "counters": {
            "domain_architectures": 17674,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17674
        }
    }
}