GET /api/protein/UniProt/M2SNG9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M2SNG9",
"id": "M2SNG9_COCSN",
"source_organism": {
"taxId": "665912",
"scientificName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652)",
"fullName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus)"
},
"name": "Prefoldin subunit 4",
"description": [
"Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins"
],
"length": 136,
"sequence": "MQRRMLTKDDEATAQSEDLEVRREDQEKINRFSSLHQKEEILEEELRAKIKEKEDLEEISGELELVDEEEKVPYKVGDCFISLPQPQVLELLSSSTEAIEGEVDALKTKLEGIQEEMGELKKALYGRFGRSINLET",
"proteome": "UP000016934",
"gene": "COCSADRAFT_41790",
"go_terms": [
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016272",
"name": "prefoldin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0051082",
"name": "unfolded protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "36da8b118b3212d7c40ed89855e8fd9deedb7b2d",
"counters": {
"domain_architectures": 17674,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17674
}
}
}