"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M2SNG9"	"{'domain_architectures': 17674, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17674}"	"['Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins']"	"COCSADRAFT_41790"	"[{'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016272', 'name': 'prefoldin complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0051082', 'name': 'unfolded protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M2SNG9_COCSN"	"36da8b118b3212d7c40ed89855e8fd9deedb7b2d"	True	False	False	136	"Prefoldin subunit 4"	3	"UP000016934"	"MQRRMLTKDDEATAQSEDLEVRREDQEKINRFSSLHQKEEILEEELRAKIKEKEDLEEISGELELVDEEEKVPYKVGDCFISLPQPQVLELLSSSTEAIEGEVDALKTKLEGIQEEMGELKKALYGRFGRSINLET"	"unreviewed"	"{'taxId': '665912', 'scientificName': 'Cochliobolus sativus (strain ND90Pr / ATCC 201652)', 'fullName': 'Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus)'}"
