General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M0QVT4",
        "id": "M0QVT4_9ADEN",
        "source_organism": {
            "taxId": "245072",
            "scientificName": "Human adenovirus 51",
            "fullName": "Human adenovirus 51"
        },
        "name": "E1B protein, small T-antigen",
        "description": [
            "Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates"
        ],
        "length": 182,
        "sequence": "MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD",
        "proteome": null,
        "gene": "E1B",
        "go_terms": [
            {
                "identifier": "GO:0033668",
                "name": "symbiont-mediated suppression of host apoptosis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "993a3f79161bd04776e3fffed36cbeba0f478a83",
        "counters": {
            "domain_architectures": 332,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 332
        }
    }
}