"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M0QVT4"	"{'domain_architectures': 332, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 332}"	"['Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates']"	"E1B"	"[{'identifier': 'GO:0033668', 'name': 'symbiont-mediated suppression of host apoptosis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"M0QVT4_9ADEN"	"993a3f79161bd04776e3fffed36cbeba0f478a83"	False	False	False	182	"E1B protein, small T-antigen"	3	""	"MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD"	"unreviewed"	"{'taxId': '245072', 'scientificName': 'Human adenovirus 51', 'fullName': 'Human adenovirus 51'}"