General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M0K2P8",
        "id": "M0K2P8_9EURY",
        "source_organism": {
            "taxId": "662476",
            "scientificName": "Haloarcula marismortui ATCC 33800",
            "fullName": "Haloarcula marismortui ATCC 33800"
        },
        "name": "Translation initiation factor 5A",
        "description": [
            "Functions by promoting the formation of the first peptide bond"
        ],
        "length": 126,
        "sequence": "MAREQTEVRELDEGSYVMIEDTPCKINSYSTAKPGKHGSAKARIDAKGVFDGKKRSLSQPVDAKVWVPIVNRKQGQVVSTDGNDAQVMDLDTYDTFTMRVPEDIDLQPDDEIEYLQYEEQRKITRS",
        "proteome": "UP000011659",
        "gene": "eif5a",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043022",
                "name": "ribosome binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "16516c8a47f7a231c5126e5924a3641f574414c5",
        "counters": {
            "domain_architectures": 1483,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 1,
                "smart": 1,
                "cdd": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1483
        }
    }
}