"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M0K2P8"	"{'domain_architectures': 1483, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 1, 'smart': 1, 'cdd': 1, 'ncbifam': 2, 'pirsf': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1483}"	"['Functions by promoting the formation of the first peptide bond']"	"eif5a"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043022', 'name': 'ribosome binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003746', 'name': 'translation elongation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006414', 'name': 'translational elongation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"M0K2P8_9EURY"	"16516c8a47f7a231c5126e5924a3641f574414c5"	True	False	False	126	"Translation initiation factor 5A"	3	"UP000011659"	"MAREQTEVRELDEGSYVMIEDTPCKINSYSTAKPGKHGSAKARIDAKGVFDGKKRSLSQPVDAKVWVPIVNRKQGQVVSTDGNDAQVMDLDTYDTFTMRVPEDIDLQPDDEIEYLQYEEQRKITRS"	"unreviewed"	"{'taxId': '662476', 'scientificName': 'Haloarcula marismortui ATCC 33800', 'fullName': 'Haloarcula marismortui ATCC 33800'}"