HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L7QUB3",
"id": "L7QUB3_9NEOP",
"source_organism": {
"taxId": "431664",
"scientificName": "Stigmella anomalella",
"fullName": "Stigmella anomalella"
},
"name": "Glucose-6-phosphate 1-dehydrogenase",
"description": [
"Cytosolic glucose-6-phosphate dehydrogenase that catalyzes the first and rate-limiting step of the oxidative branch within the pentose phosphate pathway/shunt, an alternative route to glycolysis for the dissimilation of carbohydrates and a major source of reducing power and metabolic intermediates for fatty acid and nucleic acid biosynthetic processes"
],
"length": 207,
"sequence": "TLWYLYRDNLLPKNTSFIGYARSPMTIEEVREKCQRYMKVKPHEEDKLEQFWSYNSYLAGSYNQRKDFDQLNREIAKHEKGTVANRLFYLALPPSVFEEATVNIKDACIAQKGWTRVIIEKPFGRDADSSQKLSDHLASLFKEEQIYRIDHYLGKEMVQNLMTLRFANRIFVPSWNRENIASVLISFKEPFGTEGRGGYFDSFGMIR",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006006",
"name": "glucose metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004345",
"name": "glucose-6-phosphate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016614",
"name": "oxidoreductase activity, acting on CH-OH group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "53c9c531bdb96ca1196a8cffab2abbd49eca2b34",
"counters": {
"domain_architectures": 33692,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33692
}
}
}