General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7QUB3",
        "id": "L7QUB3_9NEOP",
        "source_organism": {
            "taxId": "431664",
            "scientificName": "Stigmella anomalella",
            "fullName": "Stigmella anomalella"
        },
        "name": "Glucose-6-phosphate 1-dehydrogenase",
        "description": [
            "Cytosolic glucose-6-phosphate dehydrogenase that catalyzes the first and rate-limiting step of the oxidative branch within the pentose phosphate pathway/shunt, an alternative route to glycolysis for the dissimilation of carbohydrates and a major source of reducing power and metabolic intermediates for fatty acid and nucleic acid biosynthetic processes"
        ],
        "length": 207,
        "sequence": "TLWYLYRDNLLPKNTSFIGYARSPMTIEEVREKCQRYMKVKPHEEDKLEQFWSYNSYLAGSYNQRKDFDQLNREIAKHEKGTVANRLFYLALPPSVFEEATVNIKDACIAQKGWTRVIIEKPFGRDADSSQKLSDHLASLFKEEQIYRIDHYLGKEMVQNLMTLRFANRIFVPSWNRENIASVLISFKEPFGTEGRGGYFDSFGMIR",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006006",
                "name": "glucose metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004345",
                "name": "glucose-6-phosphate dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016614",
                "name": "oxidoreductase activity, acting on CH-OH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "53c9c531bdb96ca1196a8cffab2abbd49eca2b34",
        "counters": {
            "domain_architectures": 33692,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33692
        }
    }
}