"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L7QUB3"	"{'domain_architectures': 33692, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 2, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 33692}"	"['Cytosolic glucose-6-phosphate dehydrogenase that catalyzes the first and rate-limiting step of the oxidative branch within the pentose phosphate pathway/shunt, an alternative route to glycolysis for the dissimilation of carbohydrates and a major source of reducing power and metabolic intermediates for fatty acid and nucleic acid biosynthetic processes']"	""	"[{'identifier': 'GO:0050661', 'name': 'NADP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006006', 'name': 'glucose metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004345', 'name': 'glucose-6-phosphate dehydrogenase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016614', 'name': 'oxidoreductase activity, acting on CH-OH group of donors', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"L7QUB3_9NEOP"	"53c9c531bdb96ca1196a8cffab2abbd49eca2b34"	True	False	True	207	"Glucose-6-phosphate 1-dehydrogenase"	2	""	"TLWYLYRDNLLPKNTSFIGYARSPMTIEEVREKCQRYMKVKPHEEDKLEQFWSYNSYLAGSYNQRKDFDQLNREIAKHEKGTVANRLFYLALPPSVFEEATVNIKDACIAQKGWTRVIIEKPFGRDADSSQKLSDHLASLFKEEQIYRIDHYLGKEMVQNLMTLRFANRIFVPSWNRENIASVLISFKEPFGTEGRGGYFDSFGMIR"	"unreviewed"	"{'taxId': '431664', 'scientificName': 'Stigmella anomalella', 'fullName': 'Stigmella anomalella'}"
