GET /api/protein/UniProt/L7PI50/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7PI50",
        "id": "L7PI50_9EURO",
        "source_organism": {
            "taxId": "41725",
            "scientificName": "Aspergillus aurantiobrunneus",
            "fullName": "Aspergillus aurantiobrunneus"
        },
        "name": "DNA replication licensing factor MCM7",
        "description": [
            "Acts as component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity"
        ],
        "length": 205,
        "sequence": "AVQINAYTCDRCGSEMFQPVTTKQFLPMTECESNDCKENNTKGQLFLSTRASKFIPFQEVKIQEMADQVPVGHIPRTMTVNCSGNLTRQLNPGDLVDIAGIFLPTPYTGFRAIRAGLLTDTYLEAQHITQHKKSYNDIGMDSRTLRKIEQYQKSGNMYEYLSRSIAPEIYGHLDVKKALLLLLIGGVTKEMGDGMHIRGDINICL",
        "proteome": null,
        "gene": "mcm7",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003678",
                "name": "DNA helicase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006270",
                "name": "DNA replication initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042555",
                "name": "MCM complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c4da101550b82c589ed0a28ad40713455d60288f",
        "counters": {
            "domain_architectures": 4804,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 2,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4804
        }
    }
}