General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L5MCT2",
        "id": "L5MCT2_MYODS",
        "source_organism": {
            "taxId": "225400",
            "scientificName": "Myotis davidii",
            "fullName": "Myotis davidii (David's myotis)"
        },
        "name": "Sulfiredoxin-1",
        "description": [
            "Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase"
        ],
        "length": 104,
        "sequence": "HSGCIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIRENPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTISDLRVYLGSSTPDLQ",
        "proteome": "UP000010556",
        "gene": "MDA_GLEAN10007160",
        "go_terms": [
            {
                "identifier": "GO:0032542",
                "name": "sulfiredoxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3efd499c5fb539b9601148174461bdae73932162",
        "counters": {
            "domain_architectures": 18223,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "smart": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18223
        }
    }
}