"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L5MCT2"	"{'domain_architectures': 18223, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'smart': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 18223}"	"['Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase']"	"MDA_GLEAN10007160"	"[{'identifier': 'GO:0032542', 'name': 'sulfiredoxin activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"L5MCT2_MYODS"	"3efd499c5fb539b9601148174461bdae73932162"	True	False	True	104	"Sulfiredoxin-1"	3	"UP000010556"	"HSGCIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIRENPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTISDLRVYLGSSTPDLQ"	"unreviewed"	"{'taxId': '225400', 'scientificName': 'Myotis davidii', 'fullName': ""Myotis davidii (David's myotis)""}"