General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L5KDW8",
        "id": "L5KDW8_PTEAL",
        "source_organism": {
            "taxId": "9402",
            "scientificName": "Pteropus alecto",
            "fullName": "Pteropus alecto (Black flying fox)"
        },
        "name": "Glutathione peroxidase 2",
        "description": [
            "Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis. Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl hydroperoxide, as well as several fatty acid-derived hydroperoxides. Cannot reduce phosphatidycholine hydroperoxide"
        ],
        "length": 136,
        "sequence": "MAYIAKSFYDLTAISLDGEKENCHNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI",
        "proteome": "UP000010552",
        "gene": "PAL_GLEAN10009905",
        "go_terms": [
            {
                "identifier": "GO:0004601",
                "name": "peroxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006979",
                "name": "response to oxidative stress",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48050ebc9b194292de008e161742f9888cef1ec0",
        "counters": {
            "domain_architectures": 39076,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39076
        }
    }
}