"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L5KDW8"	"{'domain_architectures': 39076, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 39076}"	"['Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis. Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl hydroperoxide, as well as several fatty acid-derived hydroperoxides. Cannot reduce phosphatidycholine hydroperoxide']"	"PAL_GLEAN10009905"	"[{'identifier': 'GO:0004601', 'name': 'peroxidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006979', 'name': 'response to oxidative stress', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"L5KDW8_PTEAL"	"48050ebc9b194292de008e161742f9888cef1ec0"	True	False	False	136	"Glutathione peroxidase 2"	3	"UP000010552"	"MAYIAKSFYDLTAISLDGEKENCHNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI"	"unreviewed"	"{'taxId': '9402', 'scientificName': 'Pteropus alecto', 'fullName': 'Pteropus alecto (Black flying fox)'}"