HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9J1K3",
"id": "K9J1K3_DESRO",
"source_organism": {
"taxId": "9430",
"scientificName": "Desmodus rotundus",
"fullName": "Desmodus rotundus (Vampire bat)"
},
"name": "ADP-ribosylation factor-like protein 1",
"description": [
"GTP-binding protein that recruits several effectors, such as golgins, arfaptins and Arf-GEFs to the trans-Golgi network, and modulates their functions at the Golgi complex. Plays thereby a role in a wide range of fundamental cellular processes, including cell polarity, innate immunity, or protein secretion mediated by arfaptins, which were shown to play a role in maintaining insulin secretion from pancreatic beta cells"
],
"length": 189,
"sequence": "TRADRWFTMGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6bc1331c4b416e231f52943c4822a3a2b702855",
"counters": {
"domain_architectures": 72767,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 3,
"pfam": 1,
"cathgene3d": 1,
"profile": 2,
"ssf": 1,
"ncbifam": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 72767
}
}
}