"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9J1K3"	"{'domain_architectures': 72767, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 3, 'pfam': 1, 'cathgene3d': 1, 'profile': 2, 'ssf': 1, 'ncbifam': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 72767}"	"['GTP-binding protein that recruits several effectors, such as golgins, arfaptins and Arf-GEFs to the trans-Golgi network, and modulates their functions at the Golgi complex. Plays thereby a role in a wide range of fundamental cellular processes, including cell polarity, innate immunity, or protein secretion mediated by arfaptins, which were shown to play a role in maintaining insulin secretion from pancreatic beta cells']"	""	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"K9J1K3_DESRO"	"d6bc1331c4b416e231f52943c4822a3a2b702855"	True	False	True	189	"ADP-ribosylation factor-like protein 1"	2	""	"TRADRWFTMGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ"	"unreviewed"	"{'taxId': '9430', 'scientificName': 'Desmodus rotundus', 'fullName': 'Desmodus rotundus (Vampire bat)'}"