HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9J061",
"id": "K9J061_DESRO",
"source_organism": {
"taxId": "9430",
"scientificName": "Desmodus rotundus",
"fullName": "Desmodus rotundus (Vampire bat)"
},
"name": "Sorbitol dehydrogenase",
"description": [
"Polyol dehydrogenase that catalyzes the reversible NAD(+)-dependent oxidation of various sugar alcohols. Is active with D-sorbitol (D-glucitol) leading to the C2-oxidized product D-fructose. Is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. May play a role in sperm motility by using sorbitol as an alternative energy source for sperm motility"
],
"length": 356,
"sequence": "MAATKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVVKVGSLVTHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPSIFFCATPPDDGNLCRFYKHNASFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVNLLVAKAMGAVQVVVTDLSASRLSKAKEAGADFVLQISKESPQEIASKVEGLLGRKPEVTIECTGAEAAIQAGIYATCPGGTLVLVGLGSEMTNVPLVHAATREVDIKGVFRYCNTWPVAISMLASKSVNVKSLVTHRFPLEKALEAFEASKKGLGLKVMIKCDPNNQDP",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
"counters": {
"domain_architectures": 323634,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"smart": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 323634
}
}
}