"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9J061"	"{'domain_architectures': 323634, 'entries': 17, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cdd': 1, 'smart': 1, 'cathgene3d': 2, 'pfam': 2, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 323634}"	"['Polyol dehydrogenase that catalyzes the reversible NAD(+)-dependent oxidation of various sugar alcohols. Is active with D-sorbitol (D-glucitol) leading to the C2-oxidized product D-fructose. Is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. May play a role in sperm motility by using sorbitol as an alternative energy source for sperm motility']"	""	"[{'identifier': 'GO:0016616', 'name': 'oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"K9J061_DESRO"	"6e6b076d581cf5733167d9dad5b9a31c66e6d8d3"	True	False	False	356	"Sorbitol dehydrogenase"	2	""	"MAATKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVVKVGSLVTHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPSIFFCATPPDDGNLCRFYKHNASFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVNLLVAKAMGAVQVVVTDLSASRLSKAKEAGADFVLQISKESPQEIASKVEGLLGRKPEVTIECTGAEAAIQAGIYATCPGGTLVLVGLGSEMTNVPLVHAATREVDIKGVFRYCNTWPVAISMLASKSVNVKSLVTHRFPLEKALEAFEASKKGLGLKVMIKCDPNNQDP"	"unreviewed"	"{'taxId': '9430', 'scientificName': 'Desmodus rotundus', 'fullName': 'Desmodus rotundus (Vampire bat)'}"
