GET /api/protein/UniProt/K9G6F9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9G6F9",
"id": "K9G6F9_PEND1",
"source_organism": {
"taxId": "1170230",
"scientificName": "Penicillium digitatum (strain Pd1 / CECT 20795)",
"fullName": "Penicillium digitatum (strain Pd1 / CECT 20795) (Green mold)"
},
"name": "Golgi SNAP receptor complex member 1",
"description": [
"Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor"
],
"length": 227,
"sequence": "MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPQSPTEEELRLQTQLRDLLERRESIIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQRLTAAISESRDRANLLSNVRSDISSYRASNPAAAEADYMLEERGRVENSHSMIDGVLSQAYAINENFGVQSETIANINRRIVGAAGSVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLMLLFFR",
"proteome": null,
"gene": "PDIP_31450",
"go_terms": [
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000139",
"name": "Golgi membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005801",
"name": "cis-Golgi network",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4600b9b5ef3dd17939fd4facc2aeabf206c35999",
"counters": {
"domain_architectures": 4974,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4974
}
}
}