General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K9G6F9",
        "id": "K9G6F9_PEND1",
        "source_organism": {
            "taxId": "1170230",
            "scientificName": "Penicillium digitatum (strain Pd1 / CECT 20795)",
            "fullName": "Penicillium digitatum (strain Pd1 / CECT 20795) (Green mold)"
        },
        "name": "Golgi SNAP receptor complex member 1",
        "description": [
            "Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor"
        ],
        "length": 227,
        "sequence": "MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPQSPTEEELRLQTQLRDLLERRESIIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQRLTAAISESRDRANLLSNVRSDISSYRASNPAAAEADYMLEERGRVENSHSMIDGVLSQAYAINENFGVQSETIANINRRIVGAAGSVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLMLLFFR",
        "proteome": null,
        "gene": "PDIP_31450",
        "go_terms": [
            {
                "identifier": "GO:0006888",
                "name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000139",
                "name": "Golgi membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005801",
                "name": "cis-Golgi network",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4600b9b5ef3dd17939fd4facc2aeabf206c35999",
        "counters": {
            "domain_architectures": 4974,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4974
        }
    }
}