"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9G6F9"	"{'domain_architectures': 4974, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4974}"	"['Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor']"	"PDIP_31450"	"[{'identifier': 'GO:0006888', 'name': 'endoplasmic reticulum to Golgi vesicle-mediated transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000139', 'name': 'Golgi membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005801', 'name': 'cis-Golgi network', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"K9G6F9_PEND1"	"4600b9b5ef3dd17939fd4facc2aeabf206c35999"	True	False	False	227	"Golgi SNAP receptor complex member 1"	3	""	"MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPQSPTEEELRLQTQLRDLLERRESIIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQRLTAAISESRDRANLLSNVRSDISSYRASNPAAAEADYMLEERGRVENSHSMIDGVLSQAYAINENFGVQSETIANINRRIVGAAGSVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLMLLFFR"	"unreviewed"	"{'taxId': '1170230', 'scientificName': 'Penicillium digitatum (strain Pd1 / CECT 20795)', 'fullName': 'Penicillium digitatum (strain Pd1 / CECT 20795) (Green mold)'}"
