General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K4HXW8",
        "id": "K4HXW8_9GEMI",
        "source_organism": {
            "taxId": "908023",
            "scientificName": "Bhendi yellow vein India virus",
            "fullName": "Bhendi yellow vein India virus"
        },
        "name": "Protein V2",
        "description": [
            "Through its interaction with host SGS3, acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs"
        ],
        "length": 121,
        "sequence": "MWDPLLNEFPDTVHGFRCMLSVKYLQLLSQDYSPDTLGYELIRDLICILRSRNYVEASCRYRHFYARVESTPASELRQPIHQPCCCPHCPRHKTTGMDKQAYEQETQNVPDVQKSGCSKGM",
        "proteome": null,
        "gene": "AV2",
        "go_terms": [
            {
                "identifier": "GO:0044003",
                "name": "symbiont-mediated perturbation of host process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0060967",
                "name": "negative regulation of gene silencing by regulatory ncRNA",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030430",
                "name": "host cell cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "5049c742507e160c725c1443e59dca4eb36f3c7e",
        "counters": {
            "domain_architectures": 2572,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2572
        }
    }
}