"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K4HXW8"	"{'domain_architectures': 2572, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2572}"	"['Through its interaction with host SGS3, acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs']"	"AV2"	"[{'identifier': 'GO:0044003', 'name': 'symbiont-mediated perturbation of host process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0060967', 'name': 'negative regulation of gene silencing by regulatory ncRNA', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030430', 'name': 'host cell cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"K4HXW8_9GEMI"	"5049c742507e160c725c1443e59dca4eb36f3c7e"	False	False	False	121	"Protein V2"	3	""	"MWDPLLNEFPDTVHGFRCMLSVKYLQLLSQDYSPDTLGYELIRDLICILRSRNYVEASCRYRHFYARVESTPASELRQPIHQPCCCPHCPRHKTTGMDKQAYEQETQNVPDVQKSGCSKGM"	"unreviewed"	"{'taxId': '908023', 'scientificName': 'Bhendi yellow vein India virus', 'fullName': 'Bhendi yellow vein India virus'}"