GET /api/protein/UniProt/K4HGG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K4HGG8",
        "id": "K4HGG8_9SAUR",
        "source_organism": {
            "taxId": "211992",
            "scientificName": "Urostrophus vautieri",
            "fullName": "Urostrophus vautieri"
        },
        "name": "Growth hormone secretagogue receptor type 1",
        "description": [
            "Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Also binds other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine)"
        ],
        "length": 149,
        "sequence": "LYLSSMAFSDLLIFLCMPLDLFRLWQYRPWNFGDLLCKLFQFVSESCTYATILNITALSVERYFAVCFPLWAKVVITKGKVKLVILVLWAVSFVSAGPIFVLVGVEHENGTNPLDTNECRTTEYAIQSGLLTIMVWTSSIFFFLPVFCL",
        "proteome": null,
        "gene": "GHSR",
        "go_terms": [
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 394800,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 394800
        }
    }
}