"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K4HGG8"	"{'domain_architectures': 394800, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 394800}"	"['Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Also binds other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine)']"	"GHSR"	"[{'identifier': 'GO:0004930', 'name': 'G protein-coupled receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007186', 'name': 'G protein-coupled receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"K4HGG8_9SAUR"	"587fa3dbe4504dc051049f3cca904dd9ab631b87"	True	False	True	149	"Growth hormone secretagogue receptor type 1"	3	""	"LYLSSMAFSDLLIFLCMPLDLFRLWQYRPWNFGDLLCKLFQFVSESCTYATILNITALSVERYFAVCFPLWAKVVITKGKVKLVILVLWAVSFVSAGPIFVLVGVEHENGTNPLDTNECRTTEYAIQSGLLTIMVWTSSIFFFLPVFCL"	"unreviewed"	"{'taxId': '211992', 'scientificName': 'Urostrophus vautieri', 'fullName': 'Urostrophus vautieri'}"
