General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K4G0J8",
        "id": "K4G0J8_CALMI",
        "source_organism": {
            "taxId": "7868",
            "scientificName": "Callorhinchus milii",
            "fullName": "Callorhinchus milii (Ghost shark)"
        },
        "name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial",
        "description": [
            "Dihydrolipoamide succinyltransferase (E2) component of the 2-oxoglutarate dehydrogenase complex. The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A"
        ],
        "length": 463,
        "sequence": "MFARCRSVSRSLSRWAVTRRPGALQASGSLGRRALSGLSVGHRVVNNNRQFQENVSKFRIFHIRHFKTSAVFNDEVMTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTAVQVPAPHAGVIEELLVPDGGKVEGGTPLFKLRKTQAGAAKPKAAEAPTAPQPAVTPPSAPAHSTGPIPTTMPPVPQVSTQPMDSKPVSAVKASAVPAGFSVEAPDAGLKGGRSEHKVKMNRMRLRIAQRLKESQNTCAMLTTFNEIDMSNIQEMRALHKETFLKKHNMKLGFMSAFVKAASFALQNQPVVNAVIDDSTKEIIYREYIDISVAVATPKGLVVPVIRNVEMMNFADIEKAINELGEKARKNELAVEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFQRPVAIQGKVEIRPMMYVALTYDHRLIDGREAVMFLRKVKAVVEDPRVLLLDI",
        "proteome": "UP000314986",
        "gene": "dlst",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004149",
                "name": "dihydrolipoyllysine-residue succinyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006099",
                "name": "tricarboxylic acid cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045252",
                "name": "oxoglutarate dehydrogenase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "696e27af6f82e2120b0f8a44f2233f48ae538bfa",
        "counters": {
            "domain_architectures": 7190,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7190
        }
    }
}