GET /api/protein/UniProt/K1VL15/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K1VL15",
"id": "K1VL15_TRIAC",
"source_organism": {
"taxId": "1220162",
"scientificName": "Trichosporon asahii var. asahii (strain CBS 8904)",
"fullName": "Trichosporon asahii var. asahii (strain CBS 8904) (Yeast)"
},
"name": "Uncharacterized protein",
"description": [
"Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum"
],
"length": 95,
"sequence": "MPASGKMAIPPAQPKVQQGGVPNDVLYKLVVFALLTAIVPVTAYFGSVRYLFDGNTQYAALLAVLSANIVLFSYVYVAFREEKAAAAQEKAAKSQ",
"proteome": "UP000006757",
"gene": "A1Q2_04288",
"go_terms": [
{
"identifier": "GO:0070072",
"name": "vacuolar proton-transporting V-type ATPase complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "179986e03afdcbedde8c358346371e5bb95ab699",
"counters": {
"domain_architectures": 3865,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3865
}
}
}