"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K1VL15"	"{'domain_architectures': 3865, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3865}"	"['Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum']"	"A1Q2_04288"	"[{'identifier': 'GO:0070072', 'name': 'vacuolar proton-transporting V-type ATPase complex assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"K1VL15_TRIAC"	"179986e03afdcbedde8c358346371e5bb95ab699"	True	False	False	95	"Uncharacterized protein"	3	"UP000006757"	"MPASGKMAIPPAQPKVQQGGVPNDVLYKLVVFALLTAIVPVTAYFGSVRYLFDGNTQYAALLAVLSANIVLFSYVYVAFREEKAAAAQEKAAKSQ"	"unreviewed"	"{'taxId': '1220162', 'scientificName': 'Trichosporon asahii var. asahii (strain CBS 8904)', 'fullName': 'Trichosporon asahii var. asahii (strain CBS 8904) (Yeast)'}"
