General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J7S6N7",
        "id": "J7S6N7_HUIN7",
        "source_organism": {
            "taxId": "1071383",
            "scientificName": "Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3)",
            "fullName": "Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3) (Yeast)"
        },
        "name": "Superoxide dismutase [Cu-Zn]",
        "description": [
            "Destroys radicals which are normally produced within the cells and which are toxic to biological systems"
        ],
        "length": 154,
        "sequence": "MVKAVAVLKGSAGIGGVVHFEQASENENTTISWEITGNDANAQRGFHIHEFGDITNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVTTDANGVAKGSRTDPLIKLLGPTTIIGRSVVIHAGTDDLGKGDNEESLKTGNAGGRPACGVIGFTN",
        "proteome": "UP000006310",
        "gene": "KNAG0D01290",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006801",
                "name": "superoxide metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0b25ab25edf1e8018697f8e0f82edf2240257a20",
        "counters": {
            "domain_architectures": 23307,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23307
        }
    }
}